PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00051.1_g00036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family CPP
Protein Properties Length: 925aa    MW: 103567 Da    PI: 7.37
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00051.1_g00036.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.92e-13136174241
                      TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                              ++k+CnCk s+Clk+YCeCfa+g++C+  C+C +C N+ e
  Rsa1.0_00051.1_g00036.1 136 KQKHCNCKASRCLKLYCECFASGSYCNG-CNCLKCLNNLE 174
                              79**************************.********976 PP

2TCR505.9e-16221260140
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                              k++kgC+Ckks ClkkYCeC++a++ Cse+C+C dCkN e
  Rsa1.0_00051.1_g00036.1 221 KHSKGCHCKKSGCLKKYCECYQANVLCSENCRCRDCKNFE 260
                              589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.3E-14135175IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.248136261IPR005172CRC domain
PfamPF036384.5E-10137172IPR005172CRC domain
SMARTSM011143.0E-19221262IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.1E-12224259IPR005172CRC domain
Gene3DG3DSA:3.40.50.18201.5E-39654800IPR029058Alpha/Beta hydrolase fold
SuperFamilySSF534748.11E-35659919IPR029058Alpha/Beta hydrolase fold
PfamPF126971.9E-8666904IPR000073Alpha/beta hydrolase fold-1
Gene3DG3DSA:3.40.50.18201.5E-39833918IPR029058Alpha/Beta hydrolase fold
Sequence ? help Back to Top
Protein Sequence    Length: 925 aa     Download sequence    Send to blast
MENTDQDLGS HRNQLARRLD FSVSAATEME MDSSQGSEKT HSILESNSNQ REGDFPPPPP  60
PSGSEDQRVK SPKPSPRSPV RSSATELSTP PQKPPPLHGF DHNPAKYRVS GKEETLTPGG  120
MQREAESKDV TTTPSKQKHC NCKASRCLKL YCECFASGSY CNGCNCLKCL NNLENETARQ  180
EAITGTLERN PDAFKPKIAG SPLGTKDLQE DVRHQLLILG KHSKGCHCKK SGCLKKYCEC  240
YQANVLCSEN CRCRDCKNFE GSQERNTLLH GPETYTQQTT NAALNRAVAT SGYLNPLESR  300
KRKSKEASHS VAARGSSAGP HLIRNGDTTL FSVPNNRAVL GPTTCTYRSS LSNTIQPRHV  360
KDLCALLVTR SVDLANKRRK NEEDPTLDPA LRDDGNETND SPDCVLDSDS VDEKPMSPAT  420
RALMCDDEHV IISEKETSAA RVKTSQEKED AYTSSESYLE QERRILSSFR DYLIQFVNRG  480
NIKGMDIKTK TNPSRKEPPE DEEQRHINSG LGQQETHKHS EQNKKSFKRE LQPSSIKKQV  540
AQTTKKHRSK TQDGIFFSPM TRAMETPTNE SVDFRSEFLR VLRSRRSPEV PLVAECSKPV  600
EDPVFQNVVP STDALESCPK ENINNLKEML KEENLHLHTE AAEQGRLPLL ILSLKEKKSE  660
ERRPAIVFMH GTNTNKEWLR PWLEAYASRG YVAIGLDSRY HGERADSKTA YIDALISSWK  720
NGDTMPFIFD TVWDLIKLAE YLTQREDIDP KRIGITGISL GGMHAWFAAA ADTRYSVTVP  780
LIGVQGFRWA IENDEWEARV NSIKPLFEEA RIDMGKSEID KEVVENVWNR ISPGLASLFD  840
SPYSLPVTAP RPLYILNGGK DPRCPLGGLV VPLERALKAY VETASPGNFK FVAEDGVGHE  900
VTSFMIKESS DWFDKFLKHR NITSC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1298303SRKRKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608797.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
STRINGBra036551.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.11e-171Tesmin/TSO1-like CXC domain-containing protein